PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kaladp0060s0233.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family NF-YC
Protein Properties Length: 271aa    MW: 29661 Da    PI: 5.1273
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kaladp0060s0233.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC58.21.8e-186861898
                NF-YC 18 nhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivpr 98
                         ++++P arikki++adedv +i+  +Pvl+ska elf+ +l   ++  + ++  +t+    ++ +v+r  ifdfl ++v +
  Kaladp0060s0233.1.p  6 DTRFPAARIKKIMQADEDVGKIAMAVPVLVSKALELFLQDLCDHTYGITVQTGAKTVSSLHLKHCVQRYSIFDFLSEVVSK 86
                         5789************************************************************************99976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.107.6E-25372IPR009072Histone-fold
SuperFamilySSF471138.02E-19489IPR009072Histone-fold
PfamPF008081.6E-18871IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005829Cellular Componentcytosol
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 271 aa     Download sequence    Send to blast
MRKKLDTRFP AARIKKIMQA DEDVGKIAMA VPVLVSKALE LFLQDLCDHT YGITVQTGAK  60
TVSSLHLKHC VQRYSIFDFL SEVVSKVPDY SHSGTSGEVR TISRRRKAAG DDLTDSDEDS  120
KRSRLPETGH ATGGGRGRGR GRGRGRGRVG RMAEPDNVQH DFEPEASMVN LDAAQANDSK  180
GRDLLSNVKE EADGLTNPAV GKFDLNAEIK ENESMPSSEV PDILSEHAVI KQERIPGWSL  240
SEIDRLNINP LQLGSMNSAL DDEDYDEEDG *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1jfi_A2e-21272575Transcription Regulator NC2 alpha chain
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1137146RGRGRGRGRG
2137147RGRGRGRGRGR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006432367.18e-85hypothetical protein CICLE_v10002081mg
TrEMBLV4SXS09e-85V4SXS0_9R
STRINGBra009295.1-P2e-71(Brassica rapa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G12480.11e-66nuclear factor Y, subunit C11